Recombinant Human Aldehyde reductase/AKR1B1 Protein, E. coli

Catalog Number: ABB-RP02938
Article Name: Recombinant Human Aldehyde reductase/AKR1B1 Protein, E. coli
Biozol Catalog Number: ABB-RP02938
Supplier Catalog Number: RP02938
Alternative Catalog Number: ABB-RP02938-100UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Phe316
Alternative Names: AKR1B1, ADR, ALDR1, ALR2, AR, aldose reductase,ADR,ALDR1,ALR2,AR
Aldose reductase (AKR1B1) belongs to the aldo/keto reductase superfamily. AKR1B1 is a NADPH-dependent aldo-keto reductase best known as the rate-limiting enzyme of the polyol pathway. Expression of AKR1B1 was the highest in lens and retina. It is the first enzyme in the polyol pathway through which glucose is converted to sorbitol which is important for the function of various organs in the body, and has been implicated in the etiology of diabetic complications. AKR1B1 is quite abundant in the collecting tubule cells and thought to provide protection against hypertonic environment. Some human tissues contain AKR1B1 as well as AKR1B10, a closely related member of the aldo-keto reductase superfamily.
Concentration: Please contact us for more information.
Molecular Weight: 37.9 kDa
Tag: N-His
NCBI: 231
UniProt: P15121
Source: E. coli
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, 20% glycerol, pH 7.5.
Sequence: MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQ
Target: Aldehyde reductase/AKR1B1
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, 20% glycerol, pH 7.5.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
Recombinant Human Aldehyde reductase/AKR1B1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.