Recombinant Human Argonaute-3/AGO3 Protein, Virus

Artikelnummer: ABB-RP02965
Artikelname: Recombinant Human Argonaute-3/AGO3 Protein, Virus
Artikelnummer: ABB-RP02965
Hersteller Artikelnummer: RP02965
Alternativnummer: ABB-RP02965-20UG
Hersteller: ABclonal
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Ala860
Alternative Synonym: EIF2C3,AGO3
Argonaute (Ago) protein family plays a key role in the RNA interference (RNAi) process in different insects including Lepidopteran. AGO3 also coexists and interacts with Armitage in the mitochondrial fraction. Furthermore, AGO3 acts in conjunction with the mitochondria-associated protein Zucchini to control the dynamic subcellular localization of Armitage between mitochondria and nuage in a Slicer-dependent fashion.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 99.6 kDa
Tag: N-His
NCBI: 192669
UniProt: Q9H9G7
Quelle: Baculovirus-Insect Cells
Reinheit: 85 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 20mM Tris, 500mM NaCl, pH 7.4, 10% gly.
Sequenz: MEIGSAGPAGAQPLLMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPRRVNREVVDSMVQHFKVTIFGDRRPVYDGKRSLYTANPLPVATTGVDLDVTLPGEGGKDRPFKVSIKFVSRVSWHLLHEVLTGRTLPEPLELDKPISTNPVHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNIDEQPRPLTDSH
Target-Kategorie: Argonaute-3/AGO3
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 20mM Tris, 500mM NaCl, pH 7.4, 10% gly.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
Recombinant Human Argonaute-3/AGO3 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.