Recombinant Human Argonaute-3/AGO3 Protein

Produktübersicht

• Artikelname: Recombinant Human Argonaute-3/AGO3 Protein
• Artikelnummer: ABB-RP02965
• Hersteller Artikelnummer: RP02965
• Alternativnummer: ABB-RP02965-20UG
• Hersteller: ABclonal
• Wirt: Virus
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Met1-Ala860
• Alternative Synonym: EIF2C3,AGO3

Produktbeschreibung

Recombinant Human Argonaute-3/AGO3 Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Met1-Ala860) of human Argonaute-3/AGO3 (Accession NP_079128.2) fused with a 6*His tag at the N-terminus.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 99.6 kDa
• Tag: N-His
• NCBI: 192669
• UniProt: Q9H9G7
• Quelle: Baculovirus-Insect Cells
• Reinheit: 85 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from a 0.22 µm filtered solution of 20mM Tris, 500mM NaCl, pH 7.4, 10% gly.
• Sequenz: MEIGSAGPAGAQPLLMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPRRVNREVVDSMVQHFKVTIFGDRRPVYDGKRSLYTANPLPVATTGVDLDVTLPGEGGKDRPFKVSIKFVSRVSWHLLHEVLTGRTLPEPLELDKPISTNPVHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNIDEQPRPLTDSH
• Target-Kategorie: Argonaute-3/AGO3

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 20mM Tris, 500mM NaCl, pH 7.4, 10% gly.
• Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag

Bilder

Recombinant Human Argonaute-3/AGO3 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.