Recombinant Human Argonaute-3/AGO3 Protein

Catalog Number: ABB-RP02965
Article Name: Recombinant Human Argonaute-3/AGO3 Protein
Biozol Catalog Number: ABB-RP02965
Supplier Catalog Number: RP02965
Alternative Catalog Number: ABB-RP02965-20UG
Manufacturer: ABclonal
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Ala860
Alternative Names: EIF2C3,AGO3
Recombinant Human Argonaute-3/AGO3 Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Met1-Ala860) of human Argonaute-3/AGO3 (Accession NP_079128.2) fused with a 6*His tag at the N-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 99.6 kDa
Tag: N-His
NCBI: 192669
UniProt: Q9H9G7
Source: Baculovirus-Insect Cells
Purity: 85 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 20mM Tris, 500mM NaCl, pH 7.4, 10% gly.
Sequence: MEIGSAGPAGAQPLLMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPRRVNREVVDSMVQHFKVTIFGDRRPVYDGKRSLYTANPLPVATTGVDLDVTLPGEGGKDRPFKVSIKFVSRVSWHLLHEVLTGRTLPEPLELDKPISTNPVHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNIDEQPRPLTDSH
Target: Argonaute-3/AGO3
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 20mM Tris, 500mM NaCl, pH 7.4, 10% gly.
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human Argonaute-3/AGO3 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.