Recombinant Human Argonaute-3/AGO3 Protein, Virus

Catalog Number: ABB-RP02965
Article Name: Recombinant Human Argonaute-3/AGO3 Protein, Virus
Biozol Catalog Number: ABB-RP02965
Supplier Catalog Number: RP02965
Alternative Catalog Number: ABB-RP02965-20UG
Manufacturer: ABclonal
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Ala860
Alternative Names: EIF2C3,AGO3
Argonaute (Ago) protein family plays a key role in the RNA interference (RNAi) process in different insects including Lepidopteran. AGO3 also coexists and interacts with Armitage in the mitochondrial fraction. Furthermore, AGO3 acts in conjunction with the mitochondria-associated protein Zucchini to control the dynamic subcellular localization of Armitage between mitochondria and nuage in a Slicer-dependent fashion.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 99.6 kDa
Tag: N-His
NCBI: 192669
UniProt: Q9H9G7
Source: Baculovirus-Insect Cells
Purity: 85 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 20mM Tris, 500mM NaCl, pH 7.4, 10% gly.
Sequence: MEIGSAGPAGAQPLLMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPRRVNREVVDSMVQHFKVTIFGDRRPVYDGKRSLYTANPLPVATTGVDLDVTLPGEGGKDRPFKVSIKFVSRVSWHLLHEVLTGRTLPEPLELDKPISTNPVHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLDIHNIDEQPRPLTDSH
Target: Argonaute-3/AGO3
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 20mM Tris, 500mM NaCl, pH 7.4, 10% gly.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein