Recombinant Human Beta-actin/ACTB Protein, E. coli

Artikelnummer: ABB-RP02968LQ
Artikelname: Recombinant Human Beta-actin/ACTB Protein, E. coli
Artikelnummer: ABB-RP02968LQ
Hersteller Artikelnummer: RP02968LQ
Alternativnummer: ABB-RP02968LQ-50UG,ABB-RP02968LQ-10UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Asp2-Phe375
Alternative Synonym: Actin Cytoplasmic 1, Beta-Actin, ACTB, beta-actin
Actins are ubiquitous globular and highly conserved proteins that are involved in various types of cell motility, structure, and integrity. Three main groups of actin isoforms, alpha, beta and gamma have been identified. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton, and as mediators of internal cell motility. ACTB is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to 4 others.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 42.8 kDa
Tag: C-His
NCBI: 60
UniProt: P60709
Quelle: E. coli
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Supplied as a 0.2 µm filtered solution of 10mM Tris-HCl, 0.1% TritonX-100, 2mM DTT, 10% Glycerol, pH 8.0.
Sequenz: DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFR
Target-Kategorie: Beta-actin
Application Verdünnung: Supplied as a 0.2 µm filtered solution of 10mM Tris-HCl, 0.1% TritonX-100, 2mM DTT, 10% Glycerol, pH 8.0.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein
Recombinant Human Beta-actin/ACTB Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.