Recombinant Human Beta-actin/ACTB Protein, E. coli

Product Overview

• Article Name: Recombinant Human Beta-actin/ACTB Protein, E. coli
• Biozol Catalog Number: ABB-RP02968LQ
• Supplier Catalog Number: RP02968LQ
• Alternative Catalog Number: ABB-RP02968LQ-50UG,ABB-RP02968LQ-10UG
• Manufacturer: ABclonal
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Asp2-Phe375
• Alternative Names: Actin Cytoplasmic 1, Beta-Actin, ACTB, beta-actin

Product Description

Actins are ubiquitous globular and highly conserved proteins that are involved in various types of cell motility, structure, and integrity. Three main groups of actin isoforms, alpha, beta and gamma have been identified. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton, and as mediators of internal cell motility. ACTB is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to 4 others.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 42.8 kDa
• Tag: C-His
• NCBI: 60
• UniProt: P60709
• Source: E. coli
• Purity: 90 % as determined by SDS-PAGE.
• Form: Supplied as a 0.2 µm filtered solution of 10mM Tris-HCl, 0.1% TritonX-100, 2mM DTT, 10% Glycerol, pH 8.0.
• Sequence: DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFR
• Target: Beta-actin

Application Notes

• Application Dilute: Supplied as a 0.2 µm filtered solution of 10mM Tris-HCl, 0.1% TritonX-100, 2mM DTT, 10% Glycerol, pH 8.0.
• Application Notes: ResearchArea: Other Recombinant Protein