Recombinant Human CISD1 Protein, E. coli

Artikelnummer: ABB-RP02993
Artikelname: Recombinant Human CISD1 Protein, E. coli
Artikelnummer: ABB-RP02993
Hersteller Artikelnummer: RP02993
Alternativnummer: ABB-RP02993-100UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Lys32-Thr108
Alternative Synonym: C10orf70, MDS029, mitoNEET, ZCD1
Mitochondrial dysfunction is thought to play a significant role in neurodegeneration observed in Parkinsons disease (PD), the loss of mitoNEET (CISD1), an iron-sulfur containing protein that regulates mitochondrial bioenergetics, results in mitochondrial dysfunction and loss of striatal dopamine and tyrosine hydroxylase. CDGSH iron sulfur domain 1 (CISD1, also termed mitoNEET), an iron-containing outer mitochondrial membrane protein, negatively regulates ferroptotic cancer cell death. At the cellular level, CISD1 gene expression increased during human adipocyte differentiation in correlation with adipogenic genes.Thus it is a possible role of CISD1 in obesity-associated dysfunctional adipogenesis in human VAT.
Konzentration: Please contact us for more information.
Molekulargewicht: 11.3 kDa
Tag: N-His
NCBI: 55847
UniProt: Q9NZ45
Quelle: E. coli
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 20 mM Tris, 150 mM NaCl, 10 % glycerol.
Sequenz: KRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Target-Kategorie: CISD1
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 20 mM Tris, 150 mM NaCl, 10 % glycerol.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
Recombinant Human CISD1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.