Recombinant Human CISD1 Protein, E. coli

Catalog Number: ABB-RP02993
Article Name: Recombinant Human CISD1 Protein, E. coli
Biozol Catalog Number: ABB-RP02993
Supplier Catalog Number: RP02993
Alternative Catalog Number: ABB-RP02993-100UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Lys32-Thr108
Alternative Names: C10orf70, MDS029, mitoNEET, ZCD1
Mitochondrial dysfunction is thought to play a significant role in neurodegeneration observed in Parkinsons disease (PD), the loss of mitoNEET (CISD1), an iron-sulfur containing protein that regulates mitochondrial bioenergetics, results in mitochondrial dysfunction and loss of striatal dopamine and tyrosine hydroxylase. CDGSH iron sulfur domain 1 (CISD1, also termed mitoNEET), an iron-containing outer mitochondrial membrane protein, negatively regulates ferroptotic cancer cell death. At the cellular level, CISD1 gene expression increased during human adipocyte differentiation in correlation with adipogenic genes.Thus it is a possible role of CISD1 in obesity-associated dysfunctional adipogenesis in human VAT.
Concentration: Please contact us for more information.
Molecular Weight: 11.3 kDa
Tag: N-His
NCBI: 55847
UniProt: Q9NZ45
Source: E. coli
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 20 mM Tris, 150 mM NaCl, 10 % glycerol.
Sequence: KRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Target: CISD1
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 20 mM Tris, 150 mM NaCl, 10 % glycerol.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
Recombinant Human CISD1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.