Recombinant Human IFI30 Protein

Artikelnummer: ABB-RP02995
Artikelname: Recombinant Human IFI30 Protein
Artikelnummer: ABB-RP02995
Hersteller Artikelnummer: RP02995
Alternativnummer: ABB-RP02995-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Lys232
Alternative Synonym: GILT, IFI-30, IFI30, IP-30, IP30
Recombinant Human IFI30 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Lys243) of human IFI30 (Accession NP_006323.2) fused with a 6*His tag at the C-terminus.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 24.7 kDa
Tag: C-His
NCBI: 10437
UniProt: P13284
Quelle: HEK293 cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from sterile PBS, pH 7.4
Sequenz: MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK
Target-Kategorie: IFI30
Application Verdünnung: Lyophilized from sterile PBS, pH 7.4
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
Recombinant Human IFI30 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.