Recombinant Human IFI30 Protein

Produktübersicht

• Artikelname: Recombinant Human IFI30 Protein
• Artikelnummer: ABB-RP02995
• Hersteller Artikelnummer: RP02995
• Alternativnummer: ABB-RP02995-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Met1-Lys232
• Alternative Synonym: GILT, IFI-30, IFI30, IP-30, IP30

Produktbeschreibung

Recombinant Human IFI30 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Lys243) of human IFI30 (Accession NP_006323.2) fused with a 6*His tag at the C-terminus.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 24.7 kDa
• Tag: C-His
• NCBI: 10437
• UniProt: P13284
• Quelle: HEK293 cells
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from sterile PBS, pH 7.4
• Sequenz: MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK
• Target-Kategorie: IFI30

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from sterile PBS, pH 7.4
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein