Recombinant Human IFI30 Protein

Product Overview

• Article Name: Recombinant Human IFI30 Protein
• Biozol Catalog Number: ABB-RP02995
• Supplier Catalog Number: RP02995
• Alternative Catalog Number: ABB-RP02995-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Met1-Lys232
• Alternative Names: GILT, IFI-30, IFI30, IP-30, IP30

Product Description

Recombinant Human IFI30 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Lys243) of human IFI30 (Accession NP_006323.2) fused with a 6*His tag at the C-terminus.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 24.7 kDa
• Tag: C-His
• NCBI: 10437
• UniProt: P13284
• Source: HEK293 cells
• Purity: 95 % as determined by SDS-PAGE.
• Form: Lyophilized from sterile PBS, pH 7.4
• Sequence: MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK
• Target: IFI30

Application Notes

• Application Dilute: Lyophilized from sterile PBS, pH 7.4
• Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein