Recombinant Human CDC42 Protein, E. coli

Produktübersicht

• Artikelname: Recombinant Human CDC42 Protein, E. coli
• Artikelnummer: ABB-RP03136
• Hersteller Artikelnummer: RP03136
• Alternativnummer: ABB-RP03136-100UG
• Hersteller: ABclonal
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Met1-Cys188
• Alternative Synonym: CDC42, CDC42Hs Protein, G25K Protein

Produktbeschreibung

Recombinant Human CDC42 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Cys188) of human CDC42 (Accession P60953-2) fused with a GST tag at the N-terminus.

Produkteigenschaften

• Konzentration: Please contact us for more information.
• Molekulargewicht: 48.1 kDa
• Tag: N-GST
• NCBI: 998
• UniProt: P60953
• Quelle: E.coli
• Reinheit: 85 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from sterile 20mM Tris, 0.15M NaCl, 0.5mM GSH, pH 8.0. Contact us for customized product form or formulation.
• Sequenz: MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
• Target-Kategorie: CDC42

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from sterile 20mM Tris, 0.15M NaCl, 0.5mM GSH, pH 8.0. Contact us for customized product form or formulation.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein