Recombinant Human CDC42 Protein, E. coli

Product Overview

• Article Name: Recombinant Human CDC42 Protein, E. coli
• Biozol Catalog Number: ABB-RP03136
• Supplier Catalog Number: RP03136
• Alternative Catalog Number: ABB-RP03136-100UG
• Manufacturer: ABclonal
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Met1-Cys188
• Alternative Names: CDC42, CDC42Hs Protein, G25K Protein

Product Description

Recombinant Human CDC42 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Cys188) of human CDC42 (Accession P60953-2) fused with a GST tag at the N-terminus.

Product Properties

• Concentration: Please contact us for more information.
• Molecular Weight: 48.1 kDa
• Tag: N-GST
• NCBI: 998
• UniProt: P60953
• Source: E.coli
• Purity: 85 % as determined by SDS-PAGE.
• Form: Lyophilized from sterile 20mM Tris, 0.15M NaCl, 0.5mM GSH, pH 8.0. Contact us for customized product form or formulation.
• Sequence: MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
• Target: CDC42

Application Notes

• Application Dilute: Lyophilized from sterile 20mM Tris, 0.15M NaCl, 0.5mM GSH, pH 8.0. Contact us for customized product form or formulation.
• Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein