Recombinant Mouse PDGF-AA Protein, Yeast

Artikelnummer: ABB-RP03145
Artikelname: Recombinant Mouse PDGF-AA Protein, Yeast
Artikelnummer: ABB-RP03145
Hersteller Artikelnummer: RP03145
Alternativnummer: ABB-RP03145-50UG
Hersteller: ABclonal
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Ser87-Arg196
Alternative Synonym: PDGF1, PDGF-A, PDGFA
Platelet-derived growth factor alpha (PDGFA) is frequently upregulated in various cancers and thought to function as a key player in the development and progression of tumor growth by regulating aspects of cell proliferation, angiogenesis and metastasis. The human platelet-derived growth factor A chain gene (PDGFA) on chromosome 7p22 encodes an important mitogen. Within PDGFA lies a complex minisatellite structure that results in partial duplications of exon 4 and the IVS4 splice donor site.
Konzentration: Please contact us for more information.
Molekulargewicht: 14.5 kDa.
Tag: N-His
NCBI: 18590
UniProt: P20033
Quelle: Pichia
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 0.1% TFA, 30% CAN. Contact us for customized product form or formulation.
Sequenz: SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRR
Target-Kategorie: PDGF-AA
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 0.1% TFA, 30% CAN. Contact us for customized product form or formulation.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors