Recombinant Mouse PDGF-AA Protein, Yeast

Catalog Number: ABB-RP03145
Article Name: Recombinant Mouse PDGF-AA Protein, Yeast
Biozol Catalog Number: ABB-RP03145
Supplier Catalog Number: RP03145
Alternative Catalog Number: ABB-RP03145-50UG
Manufacturer: ABclonal
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Ser87-Arg196
Alternative Names: PDGF1, PDGF-A, PDGFA
Platelet-derived growth factor alpha (PDGFA) is frequently upregulated in various cancers and thought to function as a key player in the development and progression of tumor growth by regulating aspects of cell proliferation, angiogenesis and metastasis. The human platelet-derived growth factor A chain gene (PDGFA) on chromosome 7p22 encodes an important mitogen. Within PDGFA lies a complex minisatellite structure that results in partial duplications of exon 4 and the IVS4 splice donor site.
Concentration: Please contact us for more information.
Molecular Weight: 14.5 kDa.
Tag: N-His
NCBI: 18590
UniProt: P20033
Source: Pichia
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 0.1% TFA, 30% CAN. Contact us for customized product form or formulation.
Sequence: SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRR
Target: PDGF-AA
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 0.1% TFA, 30% CAN. Contact us for customized product form or formulation.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors
Recombinant Mouse PDGF-AA Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.