Recombinant Human Alkaline Phosphatase (Germ type) /ALPG Protein

Artikelnummer: ABB-RP03154
Artikelname: Recombinant Human Alkaline Phosphatase (Germ type) /ALPG Protein
Artikelnummer: ABB-RP03154
Hersteller Artikelnummer: RP03154
Alternativnummer: ABB-RP03154-20UG,ABB-RP03154-100UG,ABB-RP03154-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Ile20-Thr502
Alternative Synonym: ALPG, ALPPL, ALPPL2,Alkaline phosphatase, germ cell type, EC:3.1.3.1, ALP-1, Alkaline phosphatase Nagao isozyme, Alkaline phosphatase, placental-like, Germ cell alkaline phosphatase, GCAP, Placental alkaline phosphatase-like, PLAP-like
Alkaline phosphatase can be considered our favorite enzyme for reasons apparent to those who diagnose and treat metabolic bone diseases or who study skeletal biology. Few might know, however, that alkaline phosphatase likely represents the most frequently assayed enzyme in all of medicine. Elevated activity in the circulation is universally recognized as a marker for skeletal or hepatobiliary disease.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 53.28 kDa
NCBI: 251
UniProt: P10696
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Sequenz: IIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQ
Target-Kategorie: ALPG, ALPPL, ALPPL2
Application Verdünnung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein