Recombinant Human Alkaline Phosphatase (Germ type) /ALPG Protein

Catalog Number: ABB-RP03154
Article Name: Recombinant Human Alkaline Phosphatase (Germ type) /ALPG Protein
Biozol Catalog Number: ABB-RP03154
Supplier Catalog Number: RP03154
Alternative Catalog Number: ABB-RP03154-20UG,ABB-RP03154-100UG,ABB-RP03154-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Ile20-Thr502
Alternative Names: ALPG, ALPPL, ALPPL2,Alkaline phosphatase, germ cell type, EC:3.1.3.1, ALP-1, Alkaline phosphatase Nagao isozyme, Alkaline phosphatase, placental-like, Germ cell alkaline phosphatase, GCAP, Placental alkaline phosphatase-like, PLAP-like
Alkaline phosphatase can be considered our favorite enzyme for reasons apparent to those who diagnose and treat metabolic bone diseases or who study skeletal biology. Few might know, however, that alkaline phosphatase likely represents the most frequently assayed enzyme in all of medicine. Elevated activity in the circulation is universally recognized as a marker for skeletal or hepatobiliary disease.
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 53.28 kDa
NCBI: 251
UniProt: P10696
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Sequence: IIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQ
Target: ALPG, ALPPL, ALPPL2
Application Dilute: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein