Recombinant Human Alkaline phosphatase (Placental type) /ALPP Protein

Artikelnummer: ABB-RP03155
Artikelname: Recombinant Human Alkaline phosphatase (Placental type) /ALPP Protein
Artikelnummer: ABB-RP03155
Hersteller Artikelnummer: RP03155
Alternativnummer: ABB-RP03155-20UG,ABB-RP03155-50UG,ABB-RP03155-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Ile23-Asp506
Alternative Synonym: ALPP, PLAP,Alkaline phosphatase, placental type, EC:3.1.3.1, Alkaline phosphatase Regan isozyme, Placental alkaline phosphatase 1, PLAP-1
Alkaline phosphatase can be considered our favorite enzyme for reasons apparent to those who diagnose and treat metabolic bone diseases or who study skeletal biology. Few might know, however, that alkaline phosphatase likely represents the most frequently assayed enzyme in all of medicine. Elevated activity in the circulation is universally recognized as a marker for skeletal or hepatobiliary disease.
Konzentration: < 0.01 EU/µg of the protein by LAL method
Molekulargewicht: 53.8 kDa
NCBI: 250
UniProt: P05187
Reinheit: 95 % as determined by SDS-PAGE, 95 % as determined by HPLC.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 20mM Tris-HCl, 150mM NaCl, 0.2mM CaCl2,pH 7.5.
Sequenz: IIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQ
Target-Kategorie: ALPP
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 20mM Tris-HCl, 150mM NaCl, 0.2mM CaCl2,pH 7.5.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein