Recombinant Human Alkaline phosphatase (Placental type) /ALPP Protein

Catalog Number: ABB-RP03155
Article Name: Recombinant Human Alkaline phosphatase (Placental type) /ALPP Protein
Biozol Catalog Number: ABB-RP03155
Supplier Catalog Number: RP03155
Alternative Catalog Number: ABB-RP03155-20UG,ABB-RP03155-50UG,ABB-RP03155-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Ile23-Asp506
Alternative Names: ALPP, PLAP,Alkaline phosphatase, placental type, EC:3.1.3.1, Alkaline phosphatase Regan isozyme, Placental alkaline phosphatase 1, PLAP-1
Alkaline phosphatase can be considered our favorite enzyme for reasons apparent to those who diagnose and treat metabolic bone diseases or who study skeletal biology. Few might know, however, that alkaline phosphatase likely represents the most frequently assayed enzyme in all of medicine. Elevated activity in the circulation is universally recognized as a marker for skeletal or hepatobiliary disease.
Concentration: < 0.01 EU/µg of the protein by LAL method
Molecular Weight: 53.8 kDa
NCBI: 250
UniProt: P05187
Purity: 95 % as determined by SDS-PAGE, 95 % as determined by HPLC.
Form: Lyophilized from a 0.22 µm filtered solution of 20mM Tris-HCl, 150mM NaCl, 0.2mM CaCl2,pH 7.5.
Sequence: IIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQ
Target: ALPP
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 20mM Tris-HCl, 150mM NaCl, 0.2mM CaCl2,pH 7.5.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein