Recombinant Mouse S100-A9 Protein, E. coli

Produktübersicht

• Artikelname: Recombinant Mouse S100-A9 Protein, E. coli
• Artikelnummer: ABB-RP03159LQ
• Hersteller Artikelnummer: RP03159LQ
• Alternativnummer: ABB-RP03159LQ-100UG
• Hersteller: ABclonal
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Mouse
• Immunogen: Ala2-Lys113
• Alternative Synonym: S100-A9, Calgranulin-B, Calprotectin L1H subunit, MRP-14, p14, CAGB, MRP14,S100A9

Produktbeschreibung

S100A8 and S100A9 (also known as MRP8 and MRP14, respectively) are Ca2 binding proteins belonging to the S100 family. They often exist in the form of heterodimer, while homodimer exists very little because of the stability. S100A8/A9 is constitutively expressed in neutrophils and monocytes as a Ca2 sensor, participating in cytoskeleton rearrangement and arachidonic acid metabolism.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 14.1 kDa
• Tag: N-His
• NCBI: 20202
• UniProt: P31725
• Quelle: E. coli
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Supplied as 0.22µm filtered solution in PBS, 1mM DTT, 20% Glycerol pH 7.5.
• Sequenz: ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
• Target-Kategorie: S100A9/MRP14

Anwendungsbeschreibung

• Application Verdünnung: Supplied as 0.22µm filtered solution in PBS, 1mM DTT, 20% Glycerol pH 7.5.
• Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein