Recombinant Mouse S100-A9 Protein, E. coli

Product Overview

• Article Name: Recombinant Mouse S100-A9 Protein, E. coli
• Biozol Catalog Number: ABB-RP03159LQ
• Supplier Catalog Number: RP03159LQ
• Alternative Catalog Number: ABB-RP03159LQ-100UG
• Manufacturer: ABclonal
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Immunogen: Ala2-Lys113
• Alternative Names: S100-A9, Calgranulin-B, Calprotectin L1H subunit, MRP-14, p14, CAGB, MRP14,S100A9

Product Description

S100A8 and S100A9 (also known as MRP8 and MRP14, respectively) are Ca2 binding proteins belonging to the S100 family. They often exist in the form of heterodimer, while homodimer exists very little because of the stability. S100A8/A9 is constitutively expressed in neutrophils and monocytes as a Ca2 sensor, participating in cytoskeleton rearrangement and arachidonic acid metabolism.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 14.1 kDa
• Tag: N-His
• NCBI: 20202
• UniProt: P31725
• Source: E. coli
• Purity: 95 % as determined by SDS-PAGE.
• Form: Supplied as 0.22µm filtered solution in PBS, 1mM DTT, 20% Glycerol pH 7.5.
• Sequence: ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
• Target: S100A9/MRP14

Application Notes

• Application Dilute: Supplied as 0.22µm filtered solution in PBS, 1mM DTT, 20% Glycerol pH 7.5.
• Application Notes: ResearchArea: Other Recombinant Protein