Recombinant Human PRDX4 Protein, E. coli

Produktübersicht

• Artikelname: Recombinant Human PRDX4 Protein, E. coli
• Artikelnummer: ABB-RP03163LQ
• Hersteller Artikelnummer: RP03163LQ
• Alternativnummer: ABB-RP03163LQ-10UG,ABB-RP03163LQ-50UG
• Hersteller: ABclonal
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Trp38-Asn271
• Alternative Synonym: Peroxiredoxin-4, Antioxidant Enzyme AOE372, AOE37-2, Peroxiredoxin IV, Prx-IV, Thioredoxin Peroxidase AO372, Thioredoxin-Dependent Peroxide Reductase A0372, PRDX4

Produktbeschreibung

Peroxiredoxin-4 (PRDX4) is a member of the AhpC/TSA family. PRDX4 is a cytoplasmic protein and contains one thioredoxin domain. PRDX4 exists in homodimer or heterodimer with PRDX1. PRDX4 reduces hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. In addition, PRDX4 is probably involved in redox regulation of the cell, regulating the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 28.9 KDa
• Tag: N-His
• NCBI: 10549
• UniProt: Q13162
• Quelle: E.coli
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Supplied as a 0.22 µm filtered solution in PBS, pH 7.4. Contact us for customized product form or formulation.
• Sequenz: WETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
• Target-Kategorie: PRDX4

Anwendungsbeschreibung

• Application Verdünnung: Supplied as a 0.22 µm filtered solution in PBS, pH 7.4. Contact us for customized product form or formulation.
• Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein