Recombinant Human PRDX4 Protein, E. coli

Catalog Number: ABB-RP03163LQ
Article Name: Recombinant Human PRDX4 Protein, E. coli
Biozol Catalog Number: ABB-RP03163LQ
Supplier Catalog Number: RP03163LQ
Alternative Catalog Number: ABB-RP03163LQ-50UG,ABB-RP03163LQ-10UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Trp38-Asn271
Alternative Names: Peroxiredoxin-4, Antioxidant Enzyme AOE372, AOE37-2, Peroxiredoxin IV, Prx-IV, Thioredoxin Peroxidase AO372, Thioredoxin-Dependent Peroxide Reductase A0372, PRDX4
Peroxiredoxin-4 (PRDX4) is a member of the AhpC/TSA family. PRDX4 is a cytoplasmic protein and contains one thioredoxin domain. PRDX4 exists in homodimer or heterodimer with PRDX1. PRDX4 reduces hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. In addition, PRDX4 is probably involved in redox regulation of the cell, regulating the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 28.9 KDa
Tag: N-His
NCBI: 10549
UniProt: Q13162
Source: E.coli
Purity: 95 % as determined by SDS-PAGE.
Form: Supplied as a 0.22 µm filtered solution in PBS, pH 7.4. Contact us for customized product form or formulation.
Sequence: WETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Target: PRDX4
Application Dilute: Supplied as a 0.22 µm filtered solution in PBS, pH 7.4. Contact us for customized product form or formulation.
Application Notes: ResearchArea: Other Recombinant Protein
Recombinant Human PRDX4 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.