Recombinant Human COL6A3 Protein

Produktübersicht

• Artikelname: Recombinant Human COL6A3 Protein
• Artikelnummer: ABB-RP03176
• Hersteller Artikelnummer: RP03176
• Alternativnummer: ABB-RP03176-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Thr3101-Thr3177
• Alternative Synonym: collagen, type VI, alpha 3,DYT27, UCMD1, BTHLM,COL6A3

Produktbeschreibung

Recombinant Human COL6A3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr3101-Thr3177) of human COL6A3 (Accession NP_004360.2) fused with no additional amino acid.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 8.5 kDa
• Tag: No tag
• NCBI: 1293
• UniProt: D9ZGF2
• Quelle: HEK293 cells
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
• Sequenz: TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT
• Target-Kategorie: COL6A3

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein