Recombinant Human COL6A3 Protein

Catalog Number: ABB-RP03176
Article Name: Recombinant Human COL6A3 Protein
Biozol Catalog Number: ABB-RP03176
Supplier Catalog Number: RP03176
Alternative Catalog Number: ABB-RP03176-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Thr3101-Thr3177
Alternative Names: collagen, type VI, alpha 3,DYT27, UCMD1, BTHLM,COL6A3
Recombinant Human COL6A3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr3101-Thr3177) of human COL6A3 (Accession NP_004360.2) fused with no additional amino acid.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 8.5 kDa
Tag: No tag
NCBI: 1293
UniProt: D9ZGF2
Source: HEK293 cells
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Sequence: TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT
Target: COL6A3
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
Recombinant Human COL6A3 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.