Recombinant Human CNDP1 Protein

Produktübersicht

• Artikelname: Recombinant Human CNDP1 Protein
• Artikelnummer: ABB-RP03193LQ
• Hersteller Artikelnummer: RP03193LQ
• Alternativnummer: ABB-RP03193LQ-50UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Ser27-His507
• Alternative Synonym: Beta-Ala-His Dipeptidase, CNDP Dipeptidase 1, Carnosine Dipeptidase 1, Glutamate Carboxypeptidase-Like Protein 2, Serum Carnosinase, CNDP1, CN1, CPGL2

Produktbeschreibung

Carnosine Dipeptidase 1 (CNDP1) belongs to the M20 metalloprotease family. CNDP1 is specifically expressed in the brain, serum and adult nervous central system. It is identified as human carnosinase. CNDP1 contains trinucleotide (CTG) repeat length polymorphism in the coding region and is inhibited by the metal chelator 1,10-ophenantrolin. In addition, CNDP1 can hydrolyse the beta-Ala|-His dipeptide(carnosine), anserine, Xaa-|-His dipeptides and other dipeptides including homocarnosine. CNDP1 deficiency has been associated with homocarnosinosis disease.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 54.9 kDa
• Tag: C-His
• NCBI: 84735
• UniProt: Q96KN2
• Quelle: Mammalian expression system
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Supplied as a 0.2 µm filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 7.5.
• Sequenz: ERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMAD
• Target-Kategorie: CNDP1

Anwendungsbeschreibung

• Application Verdünnung: Supplied as a 0.2 µm filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 7.5.
• Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein