Recombinant Human CNDP1 Protein

Product Overview

• Article Name: Recombinant Human CNDP1 Protein
• Biozol Catalog Number: ABB-RP03193LQ
• Supplier Catalog Number: RP03193LQ
• Alternative Catalog Number: ABB-RP03193LQ-50UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Ser27-His507
• Alternative Names: Beta-Ala-His Dipeptidase, CNDP Dipeptidase 1, Carnosine Dipeptidase 1, Glutamate Carboxypeptidase-Like Protein 2, Serum Carnosinase, CNDP1, CN1, CPGL2

Product Description

Carnosine Dipeptidase 1 (CNDP1) belongs to the M20 metalloprotease family. CNDP1 is specifically expressed in the brain, serum and adult nervous central system. It is identified as human carnosinase. CNDP1 contains trinucleotide (CTG) repeat length polymorphism in the coding region and is inhibited by the metal chelator 1,10-ophenantrolin. In addition, CNDP1 can hydrolyse the beta-Ala|-His dipeptide(carnosine), anserine, Xaa-|-His dipeptides and other dipeptides including homocarnosine. CNDP1 deficiency has been associated with homocarnosinosis disease.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 54.9 kDa
• Tag: C-His
• NCBI: 84735
• UniProt: Q96KN2
• Source: Mammalian expression system
• Purity: 95 % as determined by SDS-PAGE.
• Form: Supplied as a 0.2 µm filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 7.5.
• Sequence: ERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMAD
• Target: CNDP1

Application Notes

• Application Dilute: Supplied as a 0.2 µm filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 7.5.
• Application Notes: ResearchArea: Other Recombinant Protein