Recombinant Human CNDP1 Protein

Catalog Number: ABB-RP03193LQ
Article Name: Recombinant Human CNDP1 Protein
Biozol Catalog Number: ABB-RP03193LQ
Supplier Catalog Number: RP03193LQ
Alternative Catalog Number: ABB-RP03193LQ-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Ser27-His507
Alternative Names: Beta-Ala-His Dipeptidase, CNDP Dipeptidase 1, Carnosine Dipeptidase 1, Glutamate Carboxypeptidase-Like Protein 2, Serum Carnosinase, CNDP1, CN1, CPGL2
Carnosine Dipeptidase 1 (CNDP1) belongs to the M20 metalloprotease family. CNDP1 is specifically expressed in the brain, serum and adult nervous central system. It is identified as human carnosinase. CNDP1 contains trinucleotide (CTG) repeat length polymorphism in the coding region and is inhibited by the metal chelator 1,10-ophenantrolin. In addition, CNDP1 can hydrolyse the beta-Ala|-His dipeptide(carnosine), anserine, Xaa-|-His dipeptides and other dipeptides including homocarnosine. CNDP1 deficiency has been associated with homocarnosinosis disease.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 54.9 kDa
Tag: C-His
NCBI: 84735
UniProt: Q96KN2
Source: Mammalian expression system
Purity: 95 % as determined by SDS-PAGE.
Form: Supplied as a 0.2 µm filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 7.5.
Sequence: ERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMAD
Target: CNDP1
Application Dilute: Supplied as a 0.2 µm filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 7.5.
Application Notes: ResearchArea: Other Recombinant Protein
Recombinant Human CNDP1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.