Recombinant Human LAP3 Protein

Artikelnummer: ABB-RP03194
Artikelname: Recombinant Human LAP3 Protein
Artikelnummer: ABB-RP03194
Hersteller Artikelnummer: RP03194
Alternativnummer: ABB-RP03194-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Ala519
Alternative Synonym: HEL-S-106, LAP, LAPEP, PEPS, LAP3
LAP3 (Leucine Aminopeptidase 3) is a Protein Coding gene. 2 alternative initiation human isoforms have been reported. LAP3, belonging to the peptidase M17 family, has been proved to catalyze the hydrolysis of leucine residues. It catalyzes the removal of unsubstituted N-terminal amino acids from various peptides and is presumably involved in the processing and regular turnover of intracellular proteins. Leucine aminopeptidases are involved in many pathological disorders and regulate cell proliferation, invasion, and/or angiogenesis of tumors. A recent study showed that LAP3 is highly expressed in several malignant and affects tumor angiogenesis. LAP3 is widely expressed in the appendix, lymph node, and other tissues. Diseases associated with LAP3 include Bacterial Vaginosis and Trichomoniasis.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 57.6 kDa
Tag: C-His
NCBI: 51056
UniProt: P28838
Quelle: HEK293 cells
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from sterile 20 mM Tris, 500 mM NaCl, 20 % glycerol, pH 7.4.
Sequenz: MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRETLNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGS
Target-Kategorie: LAP3
Application Verdünnung: Lyophilized from sterile 20 mM Tris, 500 mM NaCl, 20 % glycerol, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
Recombinant Human LAP3 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.