Recombinant Human LAP3 Protein

Catalog Number: ABB-RP03194
Article Name: Recombinant Human LAP3 Protein
Biozol Catalog Number: ABB-RP03194
Supplier Catalog Number: RP03194
Alternative Catalog Number: ABB-RP03194-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Ala519
Alternative Names: HEL-S-106, LAP, LAPEP, PEPS, LAP3
LAP3 (Leucine Aminopeptidase 3) is a Protein Coding gene. 2 alternative initiation human isoforms have been reported. LAP3, belonging to the peptidase M17 family, has been proved to catalyze the hydrolysis of leucine residues. It catalyzes the removal of unsubstituted N-terminal amino acids from various peptides and is presumably involved in the processing and regular turnover of intracellular proteins. Leucine aminopeptidases are involved in many pathological disorders and regulate cell proliferation, invasion, and/or angiogenesis of tumors. A recent study showed that LAP3 is highly expressed in several malignant and affects tumor angiogenesis. LAP3 is widely expressed in the appendix, lymph node, and other tissues. Diseases associated with LAP3 include Bacterial Vaginosis and Trichomoniasis.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 57.6 kDa
Tag: C-His
NCBI: 51056
UniProt: P28838
Source: HEK293 cells
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from sterile 20 mM Tris, 500 mM NaCl, 20 % glycerol, pH 7.4.
Sequence: MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRETLNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGS
Target: LAP3
Application Dilute: Lyophilized from sterile 20 mM Tris, 500 mM NaCl, 20 % glycerol, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein