Recombinant Human Aminoacylase-3/ACY 3 Protein, E. coli

Artikelnummer: ABB-RP03196LQ
Artikelname: Recombinant Human Aminoacylase-3/ACY 3 Protein, E. coli
Artikelnummer: ABB-RP03196LQ
Hersteller Artikelnummer: RP03196LQ
Alternativnummer: ABB-RP03196LQ-50UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Ser319
Alternative Synonym: N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming),ACY3,Acylase III,Aminoacylase-3,ACY-3,Aspartoacylase-2,Hepatitis C virus core-binding protein 1,HCBP1,HCV core-binding protein 1,ASPA2,ACY3
Aspartoacylase 3, also known as ACY3, N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming), Acylase III, Aminoacylase-3, Aspartoacylase-2, Aspartoacylase-2, HCV core-binding protein 1 and ASPA2, is a member of the Aspartoacylase subfamily. ACY3 plays an important role in deacetylating mercapturic acids in kidney proximal tubules and acts on N-acetyl-aromatic amino acids.ACY3 is located in the cytoplasm of S2 and S3 proximal tubules and the apical domain of S1 proximal tubules. ACY3 protein is also expressed at low levels in stomach, testis, heart, brain, lung and liver, and may function as an HCV (Hepatitis C virus) core binding protein.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 37.4 KDa.
Tag: C-His
NCBI: 91703
UniProt: Q96HD9
Quelle: E. coli
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Supplied as a 0.2 µm filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0.
Sequenz: MCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLNRTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTANMGTCLIAKSSHEVFAMHLCRHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELGPQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFEMEAYRPVGVVDFPRTEAGHLAGTVHPQLQDRDFQPL
Target-Kategorie: ACY3
Application Verdünnung: Supplied as a 0.2 µm filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein