Recombinant Human Aminoacylase-3/ACY 3 Protein, E. coli

Catalog Number: ABB-RP03196LQ
Article Name: Recombinant Human Aminoacylase-3/ACY 3 Protein, E. coli
Biozol Catalog Number: ABB-RP03196LQ
Supplier Catalog Number: RP03196LQ
Alternative Catalog Number: ABB-RP03196LQ-50UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Ser319
Alternative Names: N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming),ACY3,Acylase III,Aminoacylase-3,ACY-3,Aspartoacylase-2,Hepatitis C virus core-binding protein 1,HCBP1,HCV core-binding protein 1,ASPA2,ACY3
Aspartoacylase 3, also known as ACY3, N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming), Acylase III, Aminoacylase-3, Aspartoacylase-2, Aspartoacylase-2, HCV core-binding protein 1 and ASPA2, is a member of the Aspartoacylase subfamily. ACY3 plays an important role in deacetylating mercapturic acids in kidney proximal tubules and acts on N-acetyl-aromatic amino acids.ACY3 is located in the cytoplasm of S2 and S3 proximal tubules and the apical domain of S1 proximal tubules. ACY3 protein is also expressed at low levels in stomach, testis, heart, brain, lung and liver, and may function as an HCV (Hepatitis C virus) core binding protein.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 37.4 KDa.
Tag: C-His
NCBI: 91703
UniProt: Q96HD9
Source: E. coli
Purity: 90 % as determined by SDS-PAGE.
Form: Supplied as a 0.2 µm filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0.
Sequence: MCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLNRTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTANMGTCLIAKSSHEVFAMHLCRHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELGPQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFEMEAYRPVGVVDFPRTEAGHLAGTVHPQLQDRDFQPL
Target: ACY3
Application Dilute: Supplied as a 0.2 µm filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0.
Application Notes: ResearchArea: Other Recombinant Protein