Recombinant Human Aminoacylase 1/ACY 1 Protein, Virus

Artikelnummer: ABB-RP03197
Artikelname: Recombinant Human Aminoacylase 1/ACY 1 Protein, Virus
Artikelnummer: ABB-RP03197
Hersteller Artikelnummer: RP03197
Alternativnummer: ABB-RP03197-50UG
Hersteller: ABclonal
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met 1-Ser 408
Alternative Synonym: ACY1,Aminoacylase-1, ACY-1, 3.5.1.14, N-acyl-L-amino-acid amidohydrolase
Aminoacylase 1 (ACY1), a metalloenzyme that removes amide-linked ACY1 groups from amino acids and may play a role in regulating responses to oxidative stress. Both the C-terminal fragment found in the two-hybrid screen and full-length ACY1 co-immunoprecipitate with SphK1. Though both C-terminal and full-length proteins slightly reduce SphK1 activity measured in vitro, the C-terminal fragment inhibits while full-length ACY1 potentiates the effects of SphK1 on proliferation and apoptosis. It suggested that ACY1 physically interacts with SphK1 and may influence its physiological functions. As a homodimeric zinc-binding enzyme, Aminoacylase 1 catalyzes the hydrolysis of N alpha-acylated amino acids. Deficiency of Aminoacylase 1 due to mutations in the Aminoacylase 1 (ACY1) gene follows an autosomal-recessive trait of inheritance and is characterized by accumulation of N-acetyl amino acids in the urine.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 47.3 kDa
Tag: C-His
NCBI: 95
UniProt: Q03154
Quelle: Baculovirus-Insect Cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from sterile 50mM Tris, 100mM NaCl, pH 8.0, 10% glycerol
Sequenz: MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTK
Target-Kategorie: Aminoacylase 1
Application Verdünnung: Lyophilized from sterile 50mM Tris, 100mM NaCl, pH 8.0, 10% glycerol
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein
Recombinant Human Aminoacylase 1/ACY 1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.