Recombinant Human Aminoacylase 1/ACY 1 Protein, Virus

Catalog Number: ABB-RP03197
Article Name: Recombinant Human Aminoacylase 1/ACY 1 Protein, Virus
Biozol Catalog Number: ABB-RP03197
Supplier Catalog Number: RP03197
Alternative Catalog Number: ABB-RP03197-50UG
Manufacturer: ABclonal
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met 1-Ser 408
Alternative Names: ACY1,Aminoacylase-1, ACY-1, 3.5.1.14, N-acyl-L-amino-acid amidohydrolase
Aminoacylase 1 (ACY1), a metalloenzyme that removes amide-linked ACY1 groups from amino acids and may play a role in regulating responses to oxidative stress. Both the C-terminal fragment found in the two-hybrid screen and full-length ACY1 co-immunoprecipitate with SphK1. Though both C-terminal and full-length proteins slightly reduce SphK1 activity measured in vitro, the C-terminal fragment inhibits while full-length ACY1 potentiates the effects of SphK1 on proliferation and apoptosis. It suggested that ACY1 physically interacts with SphK1 and may influence its physiological functions. As a homodimeric zinc-binding enzyme, Aminoacylase 1 catalyzes the hydrolysis of N alpha-acylated amino acids. Deficiency of Aminoacylase 1 due to mutations in the Aminoacylase 1 (ACY1) gene follows an autosomal-recessive trait of inheritance and is characterized by accumulation of N-acetyl amino acids in the urine.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 47.3 kDa
Tag: C-His
NCBI: 95
UniProt: Q03154
Source: Baculovirus-Insect Cells
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from sterile 50mM Tris, 100mM NaCl, pH 8.0, 10% glycerol
Sequence: MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTK
Target: Aminoacylase 1
Application Dilute: Lyophilized from sterile 50mM Tris, 100mM NaCl, pH 8.0, 10% glycerol
Application Notes: ResearchArea: Other Recombinant Protein
Recombinant Human Aminoacylase 1/ACY 1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.