Recombinant Human CTSA Protein

Artikelnummer: ABB-RP03198LQ
Artikelname: Recombinant Human CTSA Protein
Artikelnummer: ABB-RP03198LQ
Hersteller Artikelnummer: RP03198LQ
Alternativnummer: ABB-RP03198LQ-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Ala29-Tyr480
Alternative Synonym: Lysosomal protective protein,CTSA,Carboxypeptidase C,Carboxypeptidase L,Cathepsin A
Cathepsin A is active in cellular compartments called lysosomes. These compartments contain enzymes that digest and recycle materials when they are no longer needed. Cathepsin A interacts with the enzymes beta-galactosidase and neuraminidase 1, which play a role in the breakdown of complexes of sugar molecules (oligosaccharides) attached to certain proteins (glycoproteins) or fats (glycolipids). Cathepsin A forms a complex with these two enzymes and directs their transport within the cell to the lysosomes. Within lysosomes, cathepsin A activates the enzymes and prevents their breakdown.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 52.2 kDa
Tag: C-His
NCBI: 5476
UniProt: P10619
Quelle: HEK293 cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Supplied as a 0.2 µm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Sequenz: APDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAG
Target-Kategorie: CTSA
Application Verdünnung: Supplied as a 0.2 µm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein