Recombinant Human CTSA Protein

Catalog Number: ABB-RP03198LQ
Article Name: Recombinant Human CTSA Protein
Biozol Catalog Number: ABB-RP03198LQ
Supplier Catalog Number: RP03198LQ
Alternative Catalog Number: ABB-RP03198LQ-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Ala29-Tyr480
Alternative Names: Lysosomal protective protein,CTSA,Carboxypeptidase C,Carboxypeptidase L,Cathepsin A
Cathepsin A is active in cellular compartments called lysosomes. These compartments contain enzymes that digest and recycle materials when they are no longer needed. Cathepsin A interacts with the enzymes beta-galactosidase and neuraminidase 1, which play a role in the breakdown of complexes of sugar molecules (oligosaccharides) attached to certain proteins (glycoproteins) or fats (glycolipids). Cathepsin A forms a complex with these two enzymes and directs their transport within the cell to the lysosomes. Within lysosomes, cathepsin A activates the enzymes and prevents their breakdown.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 52.2 kDa
Tag: C-His
NCBI: 5476
UniProt: P10619
Source: HEK293 cells
Purity: 95 % as determined by SDS-PAGE.
Form: Supplied as a 0.2 µm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Sequence: APDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAG
Target: CTSA
Application Dilute: Supplied as a 0.2 µm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Application Notes: ResearchArea: Other Recombinant Protein
Recombinant Human CTSA Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.