Recombinant Human Insulysin/IDE Protein

Artikelnummer: ABB-RP03201LQ
Artikelname: Recombinant Human Insulysin/IDE Protein
Artikelnummer: ABB-RP03201LQ
Hersteller Artikelnummer: RP03201LQ
Alternativnummer: ABB-RP03201LQ-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met42-Leu1019
Alternative Synonym: Insulin-Degrading Enzyme, Abeta-Degrading Protease, Insulin Protease, Insulinase, Insulysin, IDE
Insulin-Degrading Enzyme (IDE) is a secreted enzyme that belongs to the peptidase M16 family. IDE is a large zinc-binding protease and cleaves multiple short polypeptides that vary considerably in sequence. IDE plays a role in the cellular breakdown of insulin, IAPP, glucagon, bradykinin, kallidin, and other peptides, and thereby plays a role in intercellular peptide signaling. IDE degrades amyloid formed by APP and IAPP. IDE may participate in the degradation and clearance of naturally secreted amyloid beta-protein by neurons and microglia. IDE, which migrates at 110 kDa during gel electrophoresis under denaturing conditions, has since been shown to have additional substrates, including the signaling peptides glucagon, TGF alpha and beta-endorphin.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 114.25 kDa
Tag: C-His
NCBI: 3416
UniProt: P14735
Quelle: Mammalian expression system
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Supplied as a 0.2 µm filtered solution of 20 mM Tris-HCl, 15 0mM NaCl, 0.05% Brij35, 10% Glycerol, pH 7.5.
Sequenz: MNNPAIKRIGNHITKSPEDKREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPFQEE
Target-Kategorie: IDE
Application Verdünnung: Supplied as a 0.2 µm filtered solution of 20 mM Tris-HCl, 15 0mM NaCl, 0.05% Brij35, 10% Glycerol, pH 7.5.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein
Recombinant Human Insulysin/IDE Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.