Recombinant Human Insulysin/IDE Protein

Catalog Number: ABB-RP03201LQ
Article Name: Recombinant Human Insulysin/IDE Protein
Biozol Catalog Number: ABB-RP03201LQ
Supplier Catalog Number: RP03201LQ
Alternative Catalog Number: ABB-RP03201LQ-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met42-Leu1019
Alternative Names: Insulin-Degrading Enzyme, Abeta-Degrading Protease, Insulin Protease, Insulinase, Insulysin, IDE
Insulin-Degrading Enzyme (IDE) is a secreted enzyme that belongs to the peptidase M16 family. IDE is a large zinc-binding protease and cleaves multiple short polypeptides that vary considerably in sequence. IDE plays a role in the cellular breakdown of insulin, IAPP, glucagon, bradykinin, kallidin, and other peptides, and thereby plays a role in intercellular peptide signaling. IDE degrades amyloid formed by APP and IAPP. IDE may participate in the degradation and clearance of naturally secreted amyloid beta-protein by neurons and microglia. IDE, which migrates at 110 kDa during gel electrophoresis under denaturing conditions, has since been shown to have additional substrates, including the signaling peptides glucagon, TGF alpha and beta-endorphin.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 114.25 kDa
Tag: C-His
NCBI: 3416
UniProt: P14735
Source: Mammalian expression system
Purity: 95 % as determined by SDS-PAGE.
Form: Supplied as a 0.2 µm filtered solution of 20 mM Tris-HCl, 15 0mM NaCl, 0.05% Brij35, 10% Glycerol, pH 7.5.
Sequence: MNNPAIKRIGNHITKSPEDKREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPFQEE
Target: IDE
Application Dilute: Supplied as a 0.2 µm filtered solution of 20 mM Tris-HCl, 15 0mM NaCl, 0.05% Brij35, 10% Glycerol, pH 7.5.
Application Notes: ResearchArea: Other Recombinant Protein