Recombinant Human MetAP1 Protein, E. coli

Artikelnummer: ABB-RP03202LQ
Artikelname: Recombinant Human MetAP1 Protein, E. coli
Artikelnummer: ABB-RP03202LQ
Hersteller Artikelnummer: RP03202LQ
Alternativnummer: ABB-RP03202LQ-50UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Phe386
Alternative Synonym: Methionine aminopeptidase 1, MAP 1, MetAP 1, Peptidase M 1, METAP1
Methionine Aminopeptidase 1 is a member of the M24 family of metalloproteases. METAP1 plays an important role in G(2)/M phase regulation of the cell cycle and may serve as a promising target for the discovery and development of new anticancer agents. METAP1 and METAP2 have different substrate specificity due to the differences in both size and shape of the active sites. The proteolytic removal of N-terminal methionine from nascent peptides is catalyzed by a family of enzymes known as methionine aminopeptidases (MetAPs) and is essential for cell growth. Inhibition of METAPs provides a novel strategy in developing anti-cancer drugs.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 43.2 kDa
Tag: No tag
NCBI: 23173
UniProt: P53582
Quelle: E.coli
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Supplied as a 0.2 µm filtered solution of 20 mM Tris-HCl, 500 mM NaCl, 10% Glycerol, pH 8.0.
Sequenz: MAAVETRVCETDGCSSEAKLQCPTCIKLGIQGSYFCSQECFKGSWATHKLLHKKAKDEKAKREVSSWTVEGDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYEC
Target-Kategorie: METAP1
Application Verdünnung: Supplied as a 0.2 µm filtered solution of 20 mM Tris-HCl, 500 mM NaCl, 10% Glycerol, pH 8.0.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein
Recombinant Human MetAP1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.