Recombinant Human MetAP1 Protein, E. coli

Product Overview

• Article Name: Recombinant Human MetAP1 Protein, E. coli
• Biozol Catalog Number: ABB-RP03202LQ
• Supplier Catalog Number: RP03202LQ
• Alternative Catalog Number: ABB-RP03202LQ-50UG
• Manufacturer: ABclonal
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Met1-Phe386
• Alternative Names: Methionine aminopeptidase 1, MAP 1, MetAP 1, Peptidase M 1, METAP1

Product Description

Methionine Aminopeptidase 1 is a member of the M24 family of metalloproteases. METAP1 plays an important role in G(2)/M phase regulation of the cell cycle and may serve as a promising target for the discovery and development of new anticancer agents. METAP1 and METAP2 have different substrate specificity due to the differences in both size and shape of the active sites. The proteolytic removal of N-terminal methionine from nascent peptides is catalyzed by a family of enzymes known as methionine aminopeptidases (MetAPs) and is essential for cell growth. Inhibition of METAPs provides a novel strategy in developing anti-cancer drugs.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 43.2 kDa
• Tag: No tag
• NCBI: 23173
• UniProt: P53582
• Source: E.coli
• Purity: 95 % as determined by SDS-PAGE.
• Form: Supplied as a 0.2 µm filtered solution of 20 mM Tris-HCl, 500 mM NaCl, 10% Glycerol, pH 8.0.
• Sequence: MAAVETRVCETDGCSSEAKLQCPTCIKLGIQGSYFCSQECFKGSWATHKLLHKKAKDEKAKREVSSWTVEGDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYEC
• Target: METAP1

Application Notes

• Application Dilute: Supplied as a 0.2 µm filtered solution of 20 mM Tris-HCl, 500 mM NaCl, 10% Glycerol, pH 8.0.
• Application Notes: ResearchArea: Other Recombinant Protein