Recombinant Human PRCP Protein

Artikelnummer: ABB-RP03204LQ
Artikelname: Recombinant Human PRCP Protein
Artikelnummer: ABB-RP03204LQ
Hersteller Artikelnummer: RP03204LQ
Alternativnummer: ABB-RP03204LQ-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Leu22-His496
Alternative Synonym: Lysosomal Pro-X Carboxypeptidase, Angiotensinase C, Lysosomal Carboxypeptidase C, Proline Carboxypeptidase, Prolylcarboxypeptidase, PRCP, PRCP, PCP
Lysosomal Pro-X Carboxypeptidase (PRCP) belongs to the peptidase S28 family. PRCP is detected in many tissues, with highest levels observed in placenta, lung, and liver. It is also present in the heart, brain, pancreas, and kidney. PRCP exists as a homodimer. PRCP cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH. PRCP has been shown to be an activator of the cell matrix-associated prekallikrein.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 54.5 KDa
Tag: C-His
NCBI: 5547
UniProt: P42785
Quelle: HEK293 cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Supplied as a 0.2 µm filtered solution of 20mM NaAc-HAc, 150mM NaCl, 10% Glycerol, pH4.5.
Sequenz: IALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHFGFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQH
Target-Kategorie: PRCP
Application Verdünnung: Supplied as a 0.2 µm filtered solution of 20mM NaAc-HAc, 150mM NaCl, 10% Glycerol, pH4.5.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein