Recombinant Human PRCP Protein

Catalog Number: ABB-RP03204LQ
Article Name: Recombinant Human PRCP Protein
Biozol Catalog Number: ABB-RP03204LQ
Supplier Catalog Number: RP03204LQ
Alternative Catalog Number: ABB-RP03204LQ-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Leu22-His496
Alternative Names: Lysosomal Pro-X Carboxypeptidase, Angiotensinase C, Lysosomal Carboxypeptidase C, Proline Carboxypeptidase, Prolylcarboxypeptidase, PRCP, PRCP, PCP
Lysosomal Pro-X Carboxypeptidase (PRCP) belongs to the peptidase S28 family. PRCP is detected in many tissues, with highest levels observed in placenta, lung, and liver. It is also present in the heart, brain, pancreas, and kidney. PRCP exists as a homodimer. PRCP cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH. PRCP has been shown to be an activator of the cell matrix-associated prekallikrein.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 54.5 KDa
Tag: C-His
NCBI: 5547
UniProt: P42785
Source: HEK293 cells
Purity: 95 % as determined by SDS-PAGE.
Form: Supplied as a 0.2 µm filtered solution of 20mM NaAc-HAc, 150mM NaCl, 10% Glycerol, pH4.5.
Sequence: IALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHFGFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQH
Target: PRCP
Application Dilute: Supplied as a 0.2 µm filtered solution of 20mM NaAc-HAc, 150mM NaCl, 10% Glycerol, pH4.5.
Application Notes: ResearchArea: Other Recombinant Protein
Recombinant Human PRCP Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.