Recombinant Human XPNPEP1 Protein, E. coli

Artikelnummer: ABB-RP03206LQ
Artikelname: Recombinant Human XPNPEP1 Protein, E. coli
Artikelnummer: ABB-RP03206LQ
Hersteller Artikelnummer: RP03206LQ
Alternativnummer: ABB-RP03206LQ-50UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Pro2-His623
Alternative Synonym: Xaa-Pro Aminopeptidase 1, Aminoacylproline Aminopeptidase, Cytosolic Aminopeptidase P, Soluble Aminopeptidase P, sAmp, X-Pro Aminopeptidase 1, X-Prolyl Aminopeptidase 1 Soluble, XPNPEP1, XPNPEPL, XPNPEPL1
X-Prolyl Aminopeptidase (XPNPEP1) is a proline-specific metalloaminopeptidase that specifically catalyzes the removal of any unsubstituted N-terminal amino acid that is adjacent to a penultimate proline residue. Because of its specificity toward proline, it has been suggested that X-Prolyl Aminopeptidase is important in the maturation and degradation of peptide hormones, neuropeptides, and tachykinins, as well as in the digestion of otherwise resistant dietary protein fragments, thereby complementing the pancreatic peptidases. X-Prolyl Aminopeptidase is a member of the M24 family of metalloproteases, which also contains methionine aminopeptidases, X-Pro dipeptidase, aminopeptidase P2, aminopeptidase P homolog, proliferation-associated protein 1, and suppressor of Ty homolog or chromatin-specific transcription elongation factor large subunit. It is a soluble enzyme, in contrast to the GPI-anchored Aminopeptidase P2 encoded by XPNPEP2. Deficiency of X-Prolyl Aminopeptidase results in excretion of large amounts of imino-oligopeptides in urine. Human Aminopeptidase P1 is widely expressed. The amino acid sequence of human X-Prolyl Aminopeptidase is 99%, 97%, 95%, 74% and 73% identical to that of canine, bovine, mouse/rat, Xenopus and zebrafish, respectively.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 70.6 KDa
Tag: C-His
NCBI: 7511
UniProt: Q9NQW7
Quelle: E. coli
Reinheit: 85 % as determined by SDS-PAGE.
Formulierung: Supplied as a 0.22 µm filtered solution in 20mM PB, 8% Sucrose, 100mM NaCl, 10% Glycerol, 0.05% Tween80, 0.02% Tween20, pH 7.5. Contact us for customized product form or formulation.
Sequenz: PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLG
Target-Kategorie: XPNPEP1
Application Verdünnung: Supplied as a 0.22 µm filtered solution in 20mM PB, 8% Sucrose, 100mM NaCl, 10% Glycerol, 0.05% Tween80, 0.02% Tween20, pH 7.5. Contact us for customized product form or formulation.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein