Recombinant Human XPNPEP1 Protein, E. coli

Catalog Number: ABB-RP03206LQ
Article Name: Recombinant Human XPNPEP1 Protein, E. coli
Biozol Catalog Number: ABB-RP03206LQ
Supplier Catalog Number: RP03206LQ
Alternative Catalog Number: ABB-RP03206LQ-50UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Pro2-His623
Alternative Names: Xaa-Pro Aminopeptidase 1, Aminoacylproline Aminopeptidase, Cytosolic Aminopeptidase P, Soluble Aminopeptidase P, sAmp, X-Pro Aminopeptidase 1, X-Prolyl Aminopeptidase 1 Soluble, XPNPEP1, XPNPEPL, XPNPEPL1
X-Prolyl Aminopeptidase (XPNPEP1) is a proline-specific metalloaminopeptidase that specifically catalyzes the removal of any unsubstituted N-terminal amino acid that is adjacent to a penultimate proline residue. Because of its specificity toward proline, it has been suggested that X-Prolyl Aminopeptidase is important in the maturation and degradation of peptide hormones, neuropeptides, and tachykinins, as well as in the digestion of otherwise resistant dietary protein fragments, thereby complementing the pancreatic peptidases. X-Prolyl Aminopeptidase is a member of the M24 family of metalloproteases, which also contains methionine aminopeptidases, X-Pro dipeptidase, aminopeptidase P2, aminopeptidase P homolog, proliferation-associated protein 1, and suppressor of Ty homolog or chromatin-specific transcription elongation factor large subunit. It is a soluble enzyme, in contrast to the GPI-anchored Aminopeptidase P2 encoded by XPNPEP2. Deficiency of X-Prolyl Aminopeptidase results in excretion of large amounts of imino-oligopeptides in urine. Human Aminopeptidase P1 is widely expressed. The amino acid sequence of human X-Prolyl Aminopeptidase is 99%, 97%, 95%, 74% and 73% identical to that of canine, bovine, mouse/rat, Xenopus and zebrafish, respectively.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 70.6 KDa
Tag: C-His
NCBI: 7511
UniProt: Q9NQW7
Source: E. coli
Purity: 85 % as determined by SDS-PAGE.
Form: Supplied as a 0.22 µm filtered solution in 20mM PB, 8% Sucrose, 100mM NaCl, 10% Glycerol, 0.05% Tween80, 0.02% Tween20, pH 7.5. Contact us for customized product form or formulation.
Sequence: PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLG
Target: XPNPEP1
Application Dilute: Supplied as a 0.22 µm filtered solution in 20mM PB, 8% Sucrose, 100mM NaCl, 10% Glycerol, 0.05% Tween80, 0.02% Tween20, pH 7.5. Contact us for customized product form or formulation.
Application Notes: ResearchArea: Other Recombinant Protein