Recombinant Human XPNPEP3 Protein, E. coli

Produktübersicht

• Artikelname: Recombinant Human XPNPEP3 Protein, E. coli
• Artikelnummer: ABB-RP03207LQ
• Hersteller Artikelnummer: RP03207LQ
• Alternativnummer: ABB-RP03207LQ-50UG
• Hersteller: ABclonal
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Met1-Ser507
• Alternative Synonym: Probable Xaa-Pro Aminopeptidase 3, X-Pro Aminopeptidase 3, Aminopeptidase P3, APP3, XPNPEP3

Produktbeschreibung

Probable Xaa-Pro Aminopeptidase 3 (XPNPEP3) is a member of the peptidase M24B family. XPNPEP3 has two isoforms and both are widely expressed. XPNPEP3 is localized in the Mitochondrion. XPNPEP3 catalyzes the release of any N-terminal amino acid, including proline, that is linked to proline, even from a dipeptide or tripeptide. Defects in XPNPEP3 are the cause of nephronophthisis-like nephropathy type 1 which is a disorder with features of nephronophthisis, a cystic kidney disease leading to end-stage renal failure.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 60.2 KDa
• Tag: N, C-6His
• NCBI: 63929
• UniProt: Q9NQH7
• Quelle: E. coli
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Supplied as a 0.22 µm filtered solution in 25mM Tris-HCl, 1mM DTT, pH 7.3. Contact us for customized product form or formulation.
• Sequenz: MPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERM
• Target-Kategorie: XPNPEP3

Anwendungsbeschreibung

• Application Verdünnung: Supplied as a 0.22 µm filtered solution in 25mM Tris-HCl, 1mM DTT, pH 7.3. Contact us for customized product form or formulation.
• Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein