Recombinant Human XPNPEP3 Protein, E. coli

Product Overview

• Article Name: Recombinant Human XPNPEP3 Protein, E. coli
• Biozol Catalog Number: ABB-RP03207LQ
• Supplier Catalog Number: RP03207LQ
• Alternative Catalog Number: ABB-RP03207LQ-50UG
• Manufacturer: ABclonal
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Met1-Ser507
• Alternative Names: Probable Xaa-Pro Aminopeptidase 3, X-Pro Aminopeptidase 3, Aminopeptidase P3, APP3, XPNPEP3

Product Description

Probable Xaa-Pro Aminopeptidase 3 (XPNPEP3) is a member of the peptidase M24B family. XPNPEP3 has two isoforms and both are widely expressed. XPNPEP3 is localized in the Mitochondrion. XPNPEP3 catalyzes the release of any N-terminal amino acid, including proline, that is linked to proline, even from a dipeptide or tripeptide. Defects in XPNPEP3 are the cause of nephronophthisis-like nephropathy type 1 which is a disorder with features of nephronophthisis, a cystic kidney disease leading to end-stage renal failure.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 60.2 KDa
• Tag: N, C-6His
• NCBI: 63929
• UniProt: Q9NQH7
• Source: E. coli
• Purity: 95 % as determined by SDS-PAGE.
• Form: Supplied as a 0.22 µm filtered solution in 25mM Tris-HCl, 1mM DTT, pH 7.3. Contact us for customized product form or formulation.
• Sequence: MPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERM
• Target: XPNPEP3

Application Notes

• Application Dilute: Supplied as a 0.22 µm filtered solution in 25mM Tris-HCl, 1mM DTT, pH 7.3. Contact us for customized product form or formulation.
• Application Notes: ResearchArea: Other Recombinant Protein