Recombinant Human ADPRH Protein, E. coli

Produktübersicht

• Artikelname: Recombinant Human ADPRH Protein, E. coli
• Artikelnummer: ABB-RP03257
• Hersteller Artikelnummer: RP03257
• Alternativnummer: ABB-RP03257-100UG
• Hersteller: ABclonal
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Met1-Leu351
• Alternative Synonym: ADPRH, ARH1, ADP-ribosylhydrolase ARH1, ADP-ribose-L-arginine cleaving enzyme

Produktbeschreibung

ADPRH belongs to the ADP-Ribosylglycohydrolase family. ADPRH specifically acts as an arginine mono-ADP-ribosylhydrolase by mediating the removal of mono-ADP-ribose attached to arginine residues on proteins. These reactions are related to cell signaling and the control of many cell processes, such as DNA repair and cell apoptosis.

Produkteigenschaften

• Konzentration: Please contact us for more information.
• Molekulargewicht: 41.7 kDa
• NCBI: 141
• UniProt: P54922
• Reinheit: 90 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
• Sequenz: MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERD
• Target-Kategorie: ADPRH

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein