Recombinant Human ADPRH Protein, E. coli

Product Overview

• Article Name: Recombinant Human ADPRH Protein, E. coli
• Biozol Catalog Number: ABB-RP03257
• Supplier Catalog Number: RP03257
• Alternative Catalog Number: ABB-RP03257-100UG
• Manufacturer: ABclonal
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Met1-Leu351
• Alternative Names: ADPRH, ARH1, ADP-ribosylhydrolase ARH1, ADP-ribose-L-arginine cleaving enzyme

Product Description

ADPRH belongs to the ADP-Ribosylglycohydrolase family. ADPRH specifically acts as an arginine mono-ADP-ribosylhydrolase by mediating the removal of mono-ADP-ribose attached to arginine residues on proteins. These reactions are related to cell signaling and the control of many cell processes, such as DNA repair and cell apoptosis.

Product Properties

• Concentration: Please contact us for more information.
• Molecular Weight: 41.7 kDa
• NCBI: 141
• UniProt: P54922
• Purity: 90 % as determined by SDS-PAGE.
• Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
• Sequence: MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERD
• Target: ADPRH

Application Notes

• Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
• Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein