Recombinant Human Histone H2A Protein, E. coli

Artikelnummer: ABB-RP03260
Artikelname: Recombinant Human Histone H2A Protein, E. coli
Artikelnummer: ABB-RP03260
Hersteller Artikelnummer: RP03260
Alternativnummer: ABB-RP03260-1000UG,ABB-RP03260-100UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Ser2-Lys130
Alternative Synonym: Histone H2A type 3, HIST3H2A, H2AC25, H2AW
HIST3H2A is a member of histones, which are a complex family of highly conserved basic proteins responsible for packaging chromosomal DNA into nucleosomes. Covalent modification of histones is important in regulating chromatin dynamics and transcription. One example of such modification is ubiquitination, which mainly occurs on histones H2A and H2B. E3 ubiquitin ligase complex is specific for histone H2A (HIST3H2A). Reducing the expression of Ring2 results in a dramatic decrease in the level of ubiquitinated H2A in HeLa cells. DNA damage induces monoubiquitylation of histone H2A (HIST3H2A) in the vicinity of DNA lesions.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 13.99 kDa
NCBI: 92815
UniProt: Q7L7L0
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequenz: SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Target-Kategorie: HIST3H2A
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein