Recombinant Human Histone H2A Protein, E. coli

Catalog Number: ABB-RP03260
Article Name: Recombinant Human Histone H2A Protein, E. coli
Biozol Catalog Number: ABB-RP03260
Supplier Catalog Number: RP03260
Alternative Catalog Number: ABB-RP03260-1000UG,ABB-RP03260-100UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Ser2-Lys130
Alternative Names: Histone H2A type 3, HIST3H2A, H2AC25, H2AW
HIST3H2A is a member of histones, which are a complex family of highly conserved basic proteins responsible for packaging chromosomal DNA into nucleosomes. Covalent modification of histones is important in regulating chromatin dynamics and transcription. One example of such modification is ubiquitination, which mainly occurs on histones H2A and H2B. E3 ubiquitin ligase complex is specific for histone H2A (HIST3H2A). Reducing the expression of Ring2 results in a dramatic decrease in the level of ubiquitinated H2A in HeLa cells. DNA damage induces monoubiquitylation of histone H2A (HIST3H2A) in the vicinity of DNA lesions.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 13.99 kDa
NCBI: 92815
UniProt: Q7L7L0
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequence: SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Target: HIST3H2A
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein