Recombinant Human Inhibin beta E/INHBE Protein

Produktübersicht

• Artikelname: Recombinant Human Inhibin beta E/INHBE Protein
• Artikelnummer: ABB-RP03275
• Hersteller Artikelnummer: RP03275
• Alternativnummer: ABB-RP03275-50UG,ABB-RP03275-100UG,ABB-RP03275-20UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Thr237-Ser350
• Alternative Synonym: INHBE,Inhibin beta E chain, Activin beta-E chain

Produktbeschreibung

The INHBE protein is an important molecular switch that coordinates the inhibin and activin systems to regulate pituitary follicle-stimulating hormone secretion. Its critical role extends to multiple physiological functions, including hormone secretion, cell development, insulin release, and bone growth.

Produkteigenschaften

• Konzentration: < 0.1 EU/µg of the protein by LAL method.
• Molekulargewicht: 39.39 kDa
• NCBI: 83729
• UniProt: P58166
• Reinheit: 90 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
• Sequenz: TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
• Target-Kategorie: INHBE

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors