Recombinant Human Inhibin beta E/INHBE Protein

Catalog Number: ABB-RP03275
Article Name: Recombinant Human Inhibin beta E/INHBE Protein
Biozol Catalog Number: ABB-RP03275
Supplier Catalog Number: RP03275
Alternative Catalog Number: ABB-RP03275-50UG,ABB-RP03275-100UG,ABB-RP03275-20UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Thr237-Ser350
Alternative Names: INHBE,Inhibin beta E chain, Activin beta-E chain
The INHBE protein is an important molecular switch that coordinates the inhibin and activin systems to regulate pituitary follicle-stimulating hormone secretion. Its critical role extends to multiple physiological functions, including hormone secretion, cell development, insulin release, and bone growth.
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 39.39 kDa
NCBI: 83729
UniProt: P58166
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Sequence: TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
Target: INHBE
Application Dilute: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors