Recombinant Human Phospholipase A2/PLA2G1B Protein

Artikelnummer: ABB-RP03277
Artikelname: Recombinant Human Phospholipase A2/PLA2G1B Protein
Artikelnummer: ABB-RP03277
Hersteller Artikelnummer: RP03277
Alternativnummer: ABB-RP03277-10UG,ABB-RP03277-50UG,ABB-RP03277-100UG,ABB-RP03277-20UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Ser148
Alternative Synonym: Phospholipase A2, PLA2G1B, PLA2, PLA2A, PPLA2
Phospholipase A2 (PLA2) plays crucial roles in diverse cellular responses, including phospholipid digestion and metabolism, host defense and signal transduction. PLA2 provides precursors for generation of eicosanoids, such as prostaglandins (PGs) and leukotrienes (LTs), when the cleaved fatty acid is arachidonic acid, platelet-activating factor (PAF) when the sn-1 position of the phosphatidylcholine contains an alkyl ether linkage and some bioactive lysophospholipids, such as lysophosphatidic acid (lysoPA).
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 17.20 kDa
NCBI: 5319
UniProt: P04054
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 10 mM Tris, 5 mM CaCl2, pH 8.0. Contact us for customized product form or formulation.
Sequenz: MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS
Target-Kategorie: PLA2G1B
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 10 mM Tris, 5 mM CaCl2, pH 8.0. Contact us for customized product form or formulation.
Anwendungsbeschreibung: Cross-Reactivity: Please contact us for reconstitution instructions. ResearchArea: Other Recombinant Protein